PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g04480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 581aa    MW: 65851 Da    PI: 7.0419
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g04480genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.26.4e-23126226198
                EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                f k lt sd++  g l++pk++a+++     +++++ +++l+ +d++g +W++k+i+r++++r+++t+GW  Fv+ ++L +gDf+vF   + ++++l+v+
  Tp4g04480 126 FSKMLTVSDTNMPGGLSIPKRHATKClppldMSQQTPTQELVAKDLNGYEWRFKHIFRGTPRRHLFTNGWTVFVSTKHLVAGDFFVFV--RGENGKLRVG 223
                77899999***********************555556679************************************************..4499999*** PP

                EE- CS
         B3  96 vfr 98 
                +++
  Tp4g04480 224 IRK 226
                *97 PP

2Auxin_resp904.3e-30252331183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++++s+F vvY+Pr   s+Fv++ +k+ +a+++++ vG+Rf m+fe e + e+r+sGtvvgv+d++p +W+nS+Wr L+
   Tp4g04480 252 AVHAINEHSTFAVVYKPRL--SQFVISEDKFADAMNNNFNVGSRFMMKFEVEGFTEKRYSGTVVGVNDFSP-HWKNSEWRRLE 331
                 79****************7..9*************************************************.********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-36122240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.4E-30124243IPR015300DNA-binding pseudobarrel domain
CDDcd100172.06E-21124226No hitNo description
PfamPF023625.3E-21126227IPR003340B3 DNA binding domain
SMARTSM010191.0E-20126228IPR003340B3 DNA binding domain
PROSITE profilePS5086313.014126228IPR003340B3 DNA binding domain
PfamPF065071.1E-25252330IPR010525Auxin response factor
PfamPF023092.0E-5503549IPR033389AUX/IAA domain
SuperFamilySSF542771.72E-8504578No hitNo description
PROSITE profilePS5174520.035514581IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MESNEVANGH PEIPGIIDST KSYLYEKLWK LCAGPFVDIP KIGENVYYFP QGHIEHLEKC  60
TNEFTSHMKQ NCDLPSKILC RVTGIHLEVE KDSDEVYSHI TLMSDLVQIA IPTPNDYCQR  120
PVVRSFSKML TVSDTNMPGG LSIPKRHATK CLPPLDMSQQ TPTQELVAKD LNGYEWRFKH  180
IFRGTPRRHL FTNGWTVFVS TKHLVAGDFF VFVRGENGKL RVGIRKAMHQ QENKASSIIS  240
TEAMHHGVIA YAVHAINEHS TFAVVYKPRL SQFVISEDKF ADAMNNNFNV GSRFMMKFEV  300
EGFTEKRYSG TVVGVNDFSP HWKNSEWRRL EVQWDENAPI RRPNKVSPWE ISLLAPSLNV  360
SQLALLPKNW PCQSNKIGST STNMLIPALN QGQEIGQSST SYPISVDQLG YHNANKDPKI  420
SSNWLMSSCS IPAMAKPNHT DQMGFPMKEH IATDSATSCR LFGVDLMDHM KTKDHLESIG  480
SYQKSEIVEK RDFDLNQTLV LSKENNSKQI HSTRNCIKVH MQGVSVGRTV DLTVLNGYNQ  540
LIDEIEKILN LKGELHNCNQ WEIVFIDNEG DMILIGDNSW P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1212435419355Auxin response factor 1
4ldw_A1e-1212435419355Auxin response factor 1
4ldw_B1e-1212435419355Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477432.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9C8N70.0ARFV_ARATH; Auxin response factor 22
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGfgenesh1_pm.C_scaffold_30027200.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34390.10.0auxin response factor 22